HPA001666

HNRNPA2B1 antibody from Sigma-Aldrich
HNRPA2B1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001666
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001666, RRID:AB_1850836
Product name
Anti-HNRPA2B1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001666
Antibody type
Polyclonal
Antigen
Heterogeneous nuclear ribonucleoproteins A2/B1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VMRDPASKRSRGFGFVTFSSMAEVDAAMAARPHSI
DGRVVEPKRAVAREESGKPGAHVTVKKLFVGGIKE
DTEEHHLRDYFEEYGKIDTIEIITDRQSGKKRGFG
FVTFDDHDPVDKIVLQKYHTINGHNAEVRKAL
Storage
-20C
Provider Type Product Number
- No reagents -