HPA021256

RNF208 antibody from MilliporeSigma / Merck KGaA
DKFZP761H1710
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA021256
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA021256, RRID:AB_1844331
Product name
Anti-RNF208 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA021256
Antibody type
Polyclonal
Antigen
RING finger protein 208 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
EGAPHTPPLPRRPRKGSSELGFPRVAPEDEVIVNQ
YVIRPGPSASAASSAAAGEPLECPTCGHSYNVTQR
RPRVLSCLHSVCEQC
Storage
-20C
Provider Type Product Number
- No reagents -