HPA021429

RNF208 antibody from Sigma-Aldrich
DKFZP761H1710
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA021429
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA021429, RRID:AB_2180654
Product name
Anti-RNF208 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA021429
Antibody type
Polyclonal
Antigen
RING finger protein 208 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
YESCPKYKFISCPTCRRETVLFTDYGLAALAVNTS
ILSRLPPEALTAPSGGQWGAEPEGSCYQTFRQYCG
AACTCHVRNPLS
Storage
-20C
Provider Type Product Number
- No reagents -