HPA029321

SNRNP200 antibody from Atlas Antibodies
ASCC3L1, BRR2, HELIC2, KIAA0788, RP33, U5-200KD
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA029321
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA029321, RRID:AB_10604096
Product name
Anti-SNRNP200
Provider product page
Atlas Antibodies - HPA029321
Antibody type
Polyclonal
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
LHPRDIDAFWLQRQLSRFYDDAIVSQKKADEVLEI
LKTASDDRECENQLVLLLGFNTFDFIKVLRQHRMM
ILYCTLLASAQSEAEKERIMGKMEADPELSKFLY
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -