H00056647-B01

BCCIP antibody from Abnova Corporation
BCCIPalpha, TOK-1

Antibody data

Product number
H00056647-B01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00056647-B01, RRID:AB_1572740
Product name
BCCIP MaxPab mouse polyclonal antibody (B01)
Provider product page
Abnova Corporation - H00056647-B01
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human BCCIP protein.
Antigen sequence
MASRSKRRAVESGVPQPPDPPVQRDEEEEKEVENE
DEDDDDSDKEKDEEDEVIDEEVNIEFEAYSLSDND
YDGIKKLLQQLFLKAPVNTAELTDLLIQQNHIGSV
IKQTDVSEDSNDDMDEDEVFGFISLLNLTERKGTQ
CVEQIQELVLRFCEKNCEKSMVEQLDKFLNDTTKP
VGLLLSERFINVPPQIALPMYQQLQKELAGAHRTN
KPCGKCYFYLLISKTFVEAEKNNSKKKPSNKKKAA
LMFANAEEEFFYEKAILKFNYSVQEESDTCLGGKW
SFDDVPMTPLRTVMLIPGDKMNEIMDKLKEYLSV
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -