Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN405089 - Provider product page

- Provider
- antibodies-online
- Product name
- anti-DEAH (Asp-Glu-Ala-His) Box Polypeptide 32 (DHX32) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-DHX32 antibody: synthetic peptide directed towards the N terminal of human DHX32
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine
- Host
- Rabbit
- Antigen sequence
EEEGLECPNSSSEKRYFPESLDSSDGDEEEVLACE
DLELN PFDGLPYSSR- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Altered distribution of heat shock protein 60 (Hsp60) with dysregulated expression of DHX32.
Application of a new bioresorbable film to guided bone regeneration in tibia defect model of the rabbits.
Chen Y, Alli Z, Ackerley C, Al-Saud B, Abdelhaleem M
Experimental and molecular pathology 2007 Jun;82(3):256-61
Experimental and molecular pathology 2007 Jun;82(3):256-61
Application of a new bioresorbable film to guided bone regeneration in tibia defect model of the rabbits.
He H, Huang J, Chen G, Dong Y
Journal of biomedical materials research. Part A 2007 Jul;82(1):256-62
Journal of biomedical materials research. Part A 2007 Jul;82(1):256-62
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image

- Experimental details
- Image(s): Western Blotting