HPA060740

MPZL2 antibody from Atlas Antibodies
EVA, EVA1
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA060740
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA060740, RRID:AB_2684352
Product name
Anti-MPZL2
Provider product page
Atlas Antibodies - HPA060740
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
VLFQHYRKKRWAERAHKVVEIKSKEEERLNQ
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -