Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- PAB29497 - Provider product page

- Provider
- Abnova Corporation
- Product name
- FMR1 polyclonal antibody
- Antibody type
- Polyclonal
- Description
- FMR1 polyclonal antibody raised against recombinant human FMR1.
- Antigen sequence
FKGNDDHSRTDNRPRNPREAKGRTTDGSLQIRVDC
NNERSVHTKTLQNTSSEGSRLRTGKDRNQKKEKPD
SVDGQQPLVNGVP- Isotype
- IgG
- Storage
- Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot (Cell lysate) analysis of Lane 1: RT-4 cell lysate, Lane 2: U-251 MG cell lysate with FMR1 polyclonal antibody (Cat# PAB29497) at 1:250 - 1:500 dilution.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescent staining of U-251 MG cells with FMR1 polyclonal antibody (Cat# PAB29497) under 1-4 ug/mL working concentration shows positivity in cytoplasm. Antibody staining is shown in green.
- Validation comment
- Immunofluorescence
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human cerebral cortex with FMR1 polyclonal antibody (Cat# PAB29497) shows strong cytoplasmic positivity in neuronal cells at 1:200 - 1:500 dilution.
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)