Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00002332-M03 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00002332-M03, RRID:AB_1111846
- Product name
- FMR1 monoclonal antibody (M03), clone 3E11
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant FMR1.
- Antigen sequence
ATKDTFHKIKLDVPEDLRQMCAKEAAHKDFKKAVG
AFSVTYDPENYQLVILSINEVTSKRAHMLIDMHFR
SLRTKLSLIMRNEEASKQLESSRQLASRFH- Isotype
- IgG
- Antibody clone number
- 3E11
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references A quantitative homogeneous assay for fragile X mental retardation 1 protein.
Schutzius G, Bleckmann D, Kapps-Fouthier S, di Giorgio F, Gerhartz B, Weiss A
Journal of neurodevelopmental disorders 2013 Apr 2;5(1):8
Journal of neurodevelopmental disorders 2013 Apr 2;5(1):8
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged FMR1 is approximately 0.03ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol