Explore
Validate
Learn
Western blot
ImmunohistochemistryAntibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations
- Immunohistochemistry [5]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA035018 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA035018, RRID:AB_10601763
- Product name
- Anti-KANSL3
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
PVLFVIGQNSLQCHPEAMEDFREKIRAENSLVVVG
GADDNLRISKAKKKSEGLTQSMVDRCIQDEIVDFL
TGVLTRAEGHMGSEPRDQDAEKKKKPR- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references An epigenetic regulator emerges as microtubule minus-end binding and stabilizing factor in mitosis.
MOF-associated complexes ensure stem cell identity and Xist repression.
Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells
Meunier S, Shvedunova M, Van Nguyen N, Avila L, Vernos I, Akhtar A
Nature communications 2015 Aug 5;6:7889
Nature communications 2015 Aug 5;6:7889
MOF-associated complexes ensure stem cell identity and Xist repression.
Chelmicki T, Dündar F, Turley MJ, Khanam T, Aktas T, Ramírez F, Gendrel AV, Wright PR, Videm P, Backofen R, Heard E, Manke T, Akhtar A
eLife 2014 May 19;3:e02024
eLife 2014 May 19;3:e02024
Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells
Stadler C, Rexhepaj E, Singan V, Murphy R, Pepperkok R, Uhlén M, Simpson J, Lundberg E
Nature Methods 2013 February;10(4):315-323
Nature Methods 2013 February;10(4):315-323
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human testis shows strong cytoplasmic and nuclear positivity in cells in seminiferous ducts.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human skeletal muscle shows no positivity in myocytes as expected.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human kidney shows strong positivity in cytoplasm in cells in tubules.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human testis shows moderate to strong nuclear and cytoplasmic positivity in cells in seminiferous ducts.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human tonsil shows weak to moderate cytoplasmic positivity in germinal center cells.
- Sample type
- HUMAN
