ABIN629622

antibody from antibodies-online

Targeting: PRPF19 hPSO4, NMP200, PRP19, PSO4, SNEV, UBOX4

Western blot

Immunohistochemistry

Antibody data

Submit

Validation data

Product number: ABIN629622 - Provider product page
Provider: antibodies-online
Product name: anti-PRP19/PSO4 Pre-MRNA Processing Factor 19 Homolog (S. Cerevisiae) (PRPF19) antibody
Antibody type: Polyclonal
Antigen: PRPF19 antibody was raised using a synthetic peptide corresponding to a region with amino acids PSVVGAGEPMDLGELVGMTPEIIQKLQDKATVLTTERKKRGKTVPEELVK
Description: Purified
Reactivity: Human, Mouse, Rat, Canine, Zebrafish
Host: Rabbit
Vial size: 100 μg
Concentration: 1 mg/mL
Storage: Store at 2-8°C for short periods. For longer periods of storage, store at -20°C.
Handling: Avoid repeated freeze/thaw cycles.

PRPF19 protein structure - ABIN629622 shown in red.