HPA027418

WEE2 antibody from Sigma-Aldrich
FLJ16107, WEE1B
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA027418
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA027418, RRID:AB_10603144
Product name
Anti-WEE2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA027418
Antibody type
Polyclonal
Antigen
WEE1 homolog 2 (S. pombe) recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
TKSGNHFEEPKLKDILLQISLGLNYIHNSSMVHLD
IKPSNIFICHKMQSESSGVIEEVENEADWFLSANV
MYKIGDLGHATSINKPKVEEGD
Storage
-20C
Provider Type Product Number
- No reagents -