HPA028713

RWDD1 antibody from MilliporeSigma / Merck KGaA
PTD013
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA028713
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA028713, RRID:AB_10601485
Product name
Anti-RWDD1 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA028713
Antibody type
Polyclonal
Antigen
RWD domain containing 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ALESIYPDSFTVLSENPPSFTITVTSEAGENDETV
QTTLKFTYSEKYPDEAPLYEIFSQENLEDNDVSD
Storage
-20C
Provider Type Product Number
- No reagents -