HPA016616

ZDHHC3 antibody from Sigma-Aldrich
GODZ, ZNF373
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA016616
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA016616, RRID:AB_1859004
Product name
Anti-ZDHHC3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA016616
Antibody type
Polyclonal
Antigen
Palmitoyltransferase ZDHHC3 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
FLHCFEEDWTTYGLNREEMAETGISLHEKMQPLNF
SSTECSSFSPPTT
Storage
-20C
Provider Type Product Number
- No reagents -