HPA016616

ZDHHC3 antibody from Atlas Antibodies
DHHC3, GODZ, ZNF373
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA016616
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA016616, RRID:AB_1859004
Product name
Anti-ZDHHC3
Provider product page
Atlas Antibodies - HPA016616
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
FLHCFEEDWTTYGLNREEMAETGISLHEKMQPLNF
SSTECSSFSPPTT
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -