Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00253738-M05 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00253738-M05, RRID:AB_565597
- Product name
- EBF3 monoclonal antibody (M05), clone 8D6
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant EBF3.
- Antigen sequence
LYGMPHNNQEIILKRAADIAEALYSVPRNHNQIPT
LGNNPAHTGMMGVNSFSSQLAVNVSETSQANDQVG
YSRNTSSVSPRGYVPSSTPQQSNYNTVSTS- Isotype
- IgG
- Antibody clone number
- 8D6
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Differential effects of a polyalanine tract expansion in Arx on neural development and gene expression.
Nasrallah MP, Cho G, Simonet JC, Putt ME, Kitamura K, Golden JA
Human molecular genetics 2012 Mar 1;21(5):1090-8
Human molecular genetics 2012 Mar 1;21(5):1090-8
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- EBF3 monoclonal antibody (M05), clone 8D6. Western Blot analysis of EBF3 expression in NIH/3T3 ( Cat # L018V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged EBF3 is approximately 0.03ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to EBF3 on formalin-fixed paraffin-embedded human lymph node. [antibody concentration 0.3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol