H00221302-B01

ZUP1 antibody from Abnova Corporation
C6orf113, dJ412I7.3, ZUFSP

Antibody data

Product number
H00221302-B01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00221302-B01, RRID:AB_1204039
Product name
C6orf113 MaxPab mouse polyclonal antibody (B01)
Provider product page
Abnova Corporation - H00221302-B01
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human C6orf113 protein.
Antigen sequence
MLSCNICGETVTSEPDMKAHLIVHMESEIICPFCK
LSGVNYDEMCFHIETAHFEQNTLERNFERINTVQY
GTSDNKKDNTLQCGMEVNSSILSGCASNHPKNSAQ
NLTKDSTLKHEGFYSENLTESRKFLKSREKQSSLT
EIKGSVYETTYSPPECPFCGKIEEHSEDMETHVKT
KHANLLDIPLEDCDQPLYDCPMCGLICTNYHILQE
HVDLHLEENSFQQGMDRVQCSGDLQLAHQLQQEED
RKRRSEESRQEIEEFQKLQRQYGLDNSGGYKQQQL
RNMEIEVNRGRMPPSEFHRRKADMMESLALGFDDG
KTKTSGIIEALHRYYQNAATDVRRVWLSSVVDHFH
SSLGDKGWGCGYRNFQMLLSSLLQNDAYDDCLKGM
LIPCIPKIQSMIEDAWKEGFDPQGASQLNNRLQGT
KAWIGACEVYILLTSLRVKCHIVDFHKSTGPLGTH
PRLFEWILNYYSSEGEGSPKVVCTSKPPIYLQHQG
HSRTVIGIEEKKNRTLCLLILDPGCPSREMQKLLK
QDIEASSLKQLRKSMGNLKHKQYQILAVEGALSLE
EKLARRQASQVFTAEKIP
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -