Antibody data

Product number
ABIN406417
Provider
antibodies-online
Product name
anti-Karyopherin alpha 5 (Importin alpha 6) (KPNA5) antibody
Provider product page
antibodies-online - ABIN406417
Antibody type
Polyclonal
Antigen
The immunogen for anti-KPNA5 antibody: synthetic peptide directed towards the C terminal of human KPNA5
Reactivity
Human, Mouse, Rat, Bovine, Chicken/Avian, Porcine
Host
Rabbit
Antigen sequence
TVMDSKIVQVALNGLENILRLGEQESKQNGIGINP
YCALI EEAYGLDKIE
Vial size
50 µg
Provider Type Product Number
- No reagents -