H00222546-B01P

RFX6 antibody from Abnova Corporation
dJ955L16.1, MGC33442, RFXDC1

Antibody data

Product number
H00222546-B01P
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00222546-B01P, RRID:AB_1137642
Product name
RFXDC1 purified MaxPab mouse polyclonal antibody (B01P)
Provider product page
Abnova Corporation - H00222546-B01P
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human RFXDC1 protein.
Antigen sequence
MAKVPKLEDTFLQAQPAPQLSPGIQEDCCVQLLGK
GLLVYPEETVYLAAEGQPGGEQGGGEKGEDPELPG
AVKSEMHLNNGNFSSEEEDADNHDSKTKAADQYLS
QKKTITQIVKDKKKQTQLTLQWLEENYIVCEGVCL
PRCILYAHYLDFCRKEKLEPACAATFGKTIRQKFP
LLTTRRLGTRGHSKYHYYGIGIKESSAYYHSVYSG
KGLTRFSGSKLKNEGGFTRKYSLSSKTGTLLPEFP
SAQHLVYQGCISKDKVDTLIMMYKTHCQCILDNAI
NGNFEEIQHFLLHFWQGMPDHLLPLLENPVIIDIF
CVCDSILYKVLTDVLIPATMQEMPESLLADIRNFA
KNWEQWVVSSLENLPEALTDKKIPIVRRFVSSLKR
QTSFLHLAQIARPALFDQHVVNSMVSDIERVDLNS
IGSQALLTISGSTDTESGIYTEHDSITVFQELKDL
LKKNATVEAFIEWLDTVVEQRVIKTSKQNGRSLKK
RAQDFLLKWSFFGARVMHNLTLNNASSFGSFHLIR
MLLDEYILLAMETQFNNDKEQELQNLLDKYMKNSD
ASKAAFTASPSSCFLANRNKGSMVSSDAVKNESHV
ETTYLPLPSSQPGGLGPALHQFPAGNTDNMPLTGQ
MELSQIAGHLMTPPISPAMASRGSVINQGPMAGRP
PSVGPVLSAPSHCSTYPEPIYPALPQANHDFYSTS
SNYQTVFRAQPHSTSGLYPHHTEHGRCMAWTEQQL
SRDFFSGSCAGSPYNSRPPSSYGPSLQAQDSHNMQ
FLNTGSFNFLSNTGAASCQGATLPPNSPNGYYGSN
INYPESHRLGSMVNQHVSVISSIRSLPPYSDIHDP
LNILDDSGRKQTSSFYTDTSSPVACRTPVLASSLQ
TPIPSSSSQCMYGTSNQYPAQETLDSHGTSSREMV
SSLPPINTVFMGTAAGGT
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -