ABIN405698

NEPRO antibody from antibodies-online
C3orf17, DKFZP434F2021, NET17
Western blot
Data presented on provider website

Antibody data

Product number
ABIN405698
Provider
antibodies-online
Product name
anti-Chromosome 3 Open Reading Frame 17 (C3orf17) (Middle Region) antibody
Provider product page
antibodies-online - ABIN405698
Antibody type
Polyclonal
Antigen
The immunogen for anti-C3orf17 antibody: synthetic peptide directed towards the middle region of human C3orf17
Description
Affinity Purified
Reactivity
Human
Host
Rabbit
Antigen sequence
KQLLNSGVSMPVIQTKEKMIHENLRGIHENETDSW
TVMQI NKNSTSGTIK
Epitope
Middle Region
Vial size
50 μg
Concentration
1mg/mL
Storage
-20°C
Handling
Avoid repeated freeze-thaw cycles.