Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN405698 - Provider product page

- Provider
- antibodies-online
- Product name
- anti-Chromosome 3 Open Reading Frame 17 (C3orf17) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-C3orf17 antibody: synthetic peptide directed towards the middle region of human C3orf17
- Description
- Affinity Purified
- Reactivity
- Human
- Host
- Rabbit
- Antigen sequence
KQLLNSGVSMPVIQTKEKMIHENLRGIHENETDSW
TVMQI NKNSTSGTIK- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Phosphoproteome analysis of the human mitotic spindle.
Nousiainen M, Silljé HH, Sauer G, Nigg EA, Körner R
Proceedings of the National Academy of Sciences of the United States of America 2006 Apr 4;103(14):5391-6
Proceedings of the National Academy of Sciences of the United States of America 2006 Apr 4;103(14):5391-6
No comments: Submit comment
No validations: Submit validation data