SAB2100302

NEPRO antibody from MilliporeSigma / Merck KGaA
C3orf17, DKFZP434F2021, NET17
No application information provided.

Antibody data

Product number
SAB2100302
Provider
MilliporeSigma / Merck KGaA
Product name
Anti-C3ORF17 (ab2) antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - SAB2100302
Antibody type
Polyclonal
Antigen
Peptide region of the protein sequence according to NP_001020243.
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KLQSTLLREIQQFSQGTRKSATDTSAKWRLSHCTV
HRTDLYPNSKQLLNS
Storage
-20C