HPA001521

ZNF615 antibody from Sigma-Aldrich
FLJ33710
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001521
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001521, RRID:AB_1080705
Product name
Anti-ZNF350 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001521
Antibody type
Polyclonal
Antigen
Zinc finger protein 350 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
FKLEQGEQLWTIEDGIHSGACSDIWKVDHVLERLQ
SESLVNRRKPCHEHDAFENIVHCSKSQFLLGQNHD
IFDLRGKSLKSNLTLVNQSKGYEIKNSVEFTGNGD
SFLHANHERLHTAIKFPASQ
Storage
-20C
Provider Type Product Number
- No reagents -