Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00010570-A01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00010570-A01, RRID:AB_463574
- Product name
- DPYSL4 polyclonal antibody (A01)
- Antibody type
- Polyclonal
- Description
- Mouse polyclonal antibody raised against a partial recombinant DPYSL4.
- Antigen sequence
VTPGAGRFVPRKTFPDFVYKRIKARNRLAEIHGVP
RGLYDGPVHEVMVPAKPGSGAPARASCPGKISVPP
VRNLHQSGFSLSGSQADDHIARRTAQKIM- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Identification of dihydropyrimidinase-related protein 4 as a novel target of the p53 tumor suppressor in the apoptotic response to DNA damage.
Kimura J, Kudoh T, Miki Y, Yoshida K
International journal of cancer 2011 Apr 1;128(7):1524-31
International journal of cancer 2011 Apr 1;128(7):1524-31
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- DPYSL4 polyclonal antibody (A01), Lot # 051206JCO1 Western Blot analysis of DPYSL4 expression in IMR-32 ( Cat # L008V1 ).