Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00051399-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00051399-M01, RRID:AB_425977
- Product name
- TRAPPC4 monoclonal antibody (M01), clone 2D10
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full length recombinant TRAPPC4.
- Antigen sequence
MAIFSVYVVNKAGGLIYQLDSYAPRAEAEKTFSYP
LDLLLKLHDERVLVAFGQRDGIRVGHAVLAINGMD
VNGRYTADGKEVLEYLGNPANYPVSIRFGRPRLTS
NEKLMLASMFHSLFAIGSQLSPEQGSSGIEMLETD
TFKLHCYQTLTGIKFVVLADPRQAGIDSLLRKIYE
IYSDFALKNPFYSLEMPIRCELFDQNLKLALEVAE
KAGTFGPGS- Isotype
- IgG
- Antibody clone number
- 2D10
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references The role of ERK2 in colorectal carcinogenesis is partly regulated by TRAPPC4.
TRAPPC2L is a novel, highly conserved TRAPP-interacting protein.
Weng YR, Kong X, Yu YN, Wang YC, Hong J, Zhao SL, Fang JY
Molecular carcinogenesis 2014 Feb;53 Suppl 1:E72-84
Molecular carcinogenesis 2014 Feb;53 Suppl 1:E72-84
TRAPPC2L is a novel, highly conserved TRAPP-interacting protein.
Scrivens PJ, Shahrzad N, Moores A, Morin A, Brunet S, Sacher M
Traffic (Copenhagen, Denmark) 2009 Jun;10(6):724-36
Traffic (Copenhagen, Denmark) 2009 Jun;10(6):724-36
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- TRAPPC4 monoclonal antibody (M01), clone 2D10 Western Blot analysis of TRAPPC4 expression in HeLa ( Cat # L013V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- TRAPPC4 monoclonal antibody (M01), clone 2D10. Western Blot analysis of TRAPPC4 expression in Raw 264.7 ( Cat # L024V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged TRAPPC4 is approximately 0.03ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to TRAPPC4 on HeLa cell. [antibody concentration 30 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol