HPA029139

CEP85L antibody from MilliporeSigma / Merck KGaA
bA57K17.2, C6orf204, NY-BR-15
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA029139
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA029139, RRID:AB_10601220
Product name
Anti-C6orf204 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA029139
Antibody type
Polyclonal
Antigen
Coiled-coil domain-containing protein C6orf204 (Serologically defined breast cancer antigen NY-BR-15) recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LDCKYKFESCSKEDFRASSSTLRRQPVDMTYSALP
ESKPIMTSSEAFEPPKYLMLGQQAVGGVPIQPSVR
TQMW
Storage
-20C
Provider Type Product Number
- No reagents -