ABIN405595
antibody from antibodies-online
Targeting: SLC37A4
G6PT1, G6PT2, G6PT3, GSD1b, GSD1c, GSD1d
Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN405595 - Provider product page

- Provider
- antibodies-online
- Product name
- anti-Solute Carrier Family 37 (Glucose-6-Phosphate Transporter), Member 4 (SLC37A4) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-SLC37A4 antibody: synthetic peptide directed towards the N terminal of human SLC37A4
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Porcine
- Host
- Rabbit
- Antigen sequence
LVEEIPLDKDDLGFITSSQSAAYAISKFVSGVLSD
QMSAR WLFSSGLLLV- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Silencing of the MT1-MMP/ G6PT axis suppresses calcium mobilization by sphingosine-1-phosphate in glioblastoma cells.
Fortier S, Labelle D, Sina A, Moreau R, Annabi B
FEBS letters 2008 Mar 5;582(5):799-804
FEBS letters 2008 Mar 5;582(5):799-804
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image

- Experimental details
- Image(s): Western Blotting
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image

- Experimental details
- Image(s): Immunohistochemistry