Antibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00010525-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00010525-M01, RRID:AB_534901
- Product name
- HYOU1 monoclonal antibody (M01), clone 6F7
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant HYOU1.
- Antigen sequence
EVQYLLNKAKFTKPRPRPKDKNGTRAEPPLNASAS
DQGEKVIPPAGQTEDAEPISEPEKVETGSEPGDTE
PLELGGPGAEPEQKEQSTGQKRPLKNDEL- Isotype
- IgG
- Antibody clone number
- 6F7
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Limited expression of reticulocalbin-1 in lymphatic endothelial cells in lung tumor but not in normal lung.
Mechanism of cancer cell adaptation to metabolic stress: proteomics identification of a novel thyroid hormone-mediated gastric carcinogenic signaling pathway.
Proteinuria and hyperglycemia induce endoplasmic reticulum stress.
Yoshida Y, Yamashita T, Nagano K, Imai S, Nabeshi H, Yoshikawa T, Yoshioka Y, Abe Y, Kamada H, Tsutsumi Y, Tsunoda S
Biochemical and biophysical research communications 2011 Feb 25;405(4):610-4
Biochemical and biophysical research communications 2011 Feb 25;405(4):610-4
Mechanism of cancer cell adaptation to metabolic stress: proteomics identification of a novel thyroid hormone-mediated gastric carcinogenic signaling pathway.
Liu R, Li Z, Bai S, Zhang H, Tang M, Lei Y, Chen L, Liang S, Zhao YL, Wei Y, Huang C
Molecular & cellular proteomics : MCP 2009 Jan;8(1):70-85
Molecular & cellular proteomics : MCP 2009 Jan;8(1):70-85
Proteinuria and hyperglycemia induce endoplasmic reticulum stress.
Lindenmeyer MT, Rastaldi MP, Ikehata M, Neusser MA, Kretzler M, Cohen CD, Schlöndorff D
Journal of the American Society of Nephrology : JASN 2008 Nov;19(11):2225-36
Journal of the American Society of Nephrology : JASN 2008 Nov;19(11):2225-36
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- HYOU1 monoclonal antibody (M01), clone 6F7 Western Blot analysis of HYOU1 expression in MCF-7 ( Cat # L046V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged HYOU1 is approximately 0.03ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to HYOU1 on formalin-fixed paraffin-embedded human salivary gland. [antibody concentration 1 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol