Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00002051-M03 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00002051-M03, RRID:AB_509399
- Product name
- EPHB6 monoclonal antibody (M03), clone 5D8
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant EPHB6.
- Antigen sequence
DTTGETSEIGWLTYPPGGWDEVSVLDDQRRLTRTF
EACHVAGAPPGTGQDNWLQTHFVERRGAQRAHIRL
HFSVRACSSLGVSGGTCRETFTLYYRQAEE- Isotype
- IgG
- Antibody clone number
- 5D8
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Dynamic interactions between cancer cells and the embryonic microenvironment regulate cell invasion and reveal EphB6 as a metastasis suppressor.
Bailey CM, Kulesa PM
Molecular cancer research : MCR 2014 Sep;12(9):1303-13
Molecular cancer research : MCR 2014 Sep;12(9):1303-13
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- EPHB6 monoclonal antibody (M03), clone 5D8. Western Blot analysis of EPHB6 expression in NIH/3T3 ( Cat # L018V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged EPHB6 is approximately 0.3ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to EPHB6 on formalin-fixed paraffin-embedded human pancreas. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol