HPA001351

EPHB6 antibody from Sigma-Aldrich
HEP
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001351
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001351, RRID:AB_10601372
Product name
Anti-EPHB6 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001351
Antibody type
Polyclonal
Antigen
EPH receptor B6 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
EVLNAIEQEFRLPPPPGCPPGLHLLMLDTWQKDRA
RRPHFDQLVAAFDKMIRKPDTLQAGGDPGERPSQA
LLTPVALDFPCLDSPQAWLSAIGLECYQDNFSKFG
LCTFSDVAQLSLEDLPALGITLAGHQKKLLHHIQL
LQQHLRQQ
Storage
-20C
Provider Type Product Number
- No reagents -