HPA014700

CERK antibody from Sigma-Aldrich
dA59H18.2, dA59H18.3, DKFZp434E0211, FLJ21430, FLJ23239, hCERK, KIAA1646, LK4
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA014700
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA014700, RRID:AB_1846545
Product name
Anti-CERK antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA014700
Antibody type
Polyclonal
Antigen
Ceramide kinase recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VEETDVHGKHQGSGKWQKMEKPYAFTVHCVKRARR
HRWKWAQVTFWCPEEQLCHLWLQTLREMLEKLTSR
PKHLLVFINPFGGKGQGKRIYERKVAPLFTLASIT
TDIIVTEHAN
Storage
-20C
Provider Type Product Number
- No reagents -