H00000523-A01
antibody from Abnova Corporation
Targeting: ATP6V1A
ATP6A1, ATP6V1A1, VA68, Vma1, VPP2
Antibody data
- Antibody Data
- Antigen structure
- References [4]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00000523-A01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00000523-A01, RRID:AB_605964
- Product name
- ATP6V1A polyclonal antibody (A01)
- Antibody type
- Polyclonal
- Description
- Mouse polyclonal antibody raised against a partial recombinant ATP6V1A.
- Antigen sequence
TLEVAKLIKDDFLQQNGYTPYDRFCPFYKTVGMLS
NMIAFYDMARRAVETTAQSDNKITWSIIREHMGDI
LYKLSSMKFKDPLKDGEAKIKSDYAQLLEDMQNAF
RSLED- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Regulated assembly of vacuolar ATPase is increased during cluster disruption-induced maturation of dendritic cells through a phosphatidylinositol 3-kinase/mTOR-dependent pathway.
A cytotoxic type III secretion effector of Vibrio parahaemolyticus targets vacuolar H+-ATPase subunit c and ruptures host cell lysosomes.
Inhibition of activated Stat3 reverses drug resistance to chemotherapeutic agents in gastric cancer cells.
Effects and mechanisms of proton pump inhibitors as a novel chemosensitizer on human gastric adenocarcinoma (SGC7901) cells.
Liberman R, Bond S, Shainheit MG, Stadecker MJ, Forgac M
The Journal of biological chemistry 2014 Jan 17;289(3):1355-63
The Journal of biological chemistry 2014 Jan 17;289(3):1355-63
A cytotoxic type III secretion effector of Vibrio parahaemolyticus targets vacuolar H+-ATPase subunit c and ruptures host cell lysosomes.
Matsuda S, Okada N, Kodama T, Honda T, Iida T
PLoS pathogens 2012;8(7):e1002803
PLoS pathogens 2012;8(7):e1002803
Inhibition of activated Stat3 reverses drug resistance to chemotherapeutic agents in gastric cancer cells.
Huang S, Chen M, Shen Y, Shen W, Guo H, Gao Q, Zou X
Cancer letters 2012 Feb 28;315(2):198-205
Cancer letters 2012 Feb 28;315(2):198-205
Effects and mechanisms of proton pump inhibitors as a novel chemosensitizer on human gastric adenocarcinoma (SGC7901) cells.
Chen M, Zou X, Luo H, Cao J, Zhang X, Zhang B, Liu W
Cell biology international 2009 Sep;33(9):1008-19
Cell biology international 2009 Sep;33(9):1008-19
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- ATP6V1A polyclonal antibody (A01), Lot # 060717JCS1. Western Blot analysis of ATP6V1A expression in Daoy.