H00000523-M02
antibody from Abnova Corporation
Targeting: ATP6V1A
ATP6A1, ATP6V1A1, VA68, Vma1, VPP2
Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00000523-M02 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00000523-M02, RRID:AB_1672274
- Product name
- ATP6V1A monoclonal antibody (M02), clone 4F5
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant ATP6V1A.
- Antigen sequence
TLEVAKLIKDDFLQQNGYTPYDRFCPFYKTVGMLS
NMIAFYDMARRAVETTAQSDNKITWSIIREHMGDI
LYKLSSMKFKDPLKDGEAKIKSDYAQLLEDMQNAF
RSLED- Isotype
- IgG
- Antibody clone number
- 4F5
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- ATP6V1A monoclonal antibody (M02), clone 4F5. Western Blot analysis of ATP6V1A expression in human kidney.
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of ATP6V1A expression in transfected 293T cell line by ATP6V1A monoclonal antibody (M02), clone 4F5.Lane 1: ATP6V1A transfected lysate (Predicted MW: 68.3 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged ATP6V1A is 0.03 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to ATP6V1A on HeLa cell . [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to ATP6V1A on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol