Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN406420 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Ferredoxin Reductase (FDXR) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-FDXR antibody: synthetic peptide directed towards the middle region of human FDXR
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine
- Host
- Rabbit
- Antigen sequence
LDPVDFLGLQDKIKEVPRPRKRLTELLLRTATEKP
GPAEA ARQASASRAW- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Fhit interaction with ferredoxin reductase triggers generation of reactive oxygen species and apoptosis of cancer cells.
Trapasso F, Pichiorri F, Gaspari M, Palumbo T, Aqeilan RI, Gaudio E, Okumura H, Iuliano R, Di Leva G, Fabbri M, Birk DE, Raso C, Green-Church K, Spagnoli LG, Venuta S, Huebner K, Croce CM
The Journal of biological chemistry 2008 May 16;283(20):13736-44
The Journal of biological chemistry 2008 May 16;283(20):13736-44
No comments: Submit comment
No validations: Submit validation data