Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN310883 - Provider product page

- Provider
- antibodies-online
- Product name
- anti-C2CD2-Like (C2CD2L) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-TMEM24 antibody: synthetic peptide directed towards the C terminal of human TMEM24
- Reactivity
- Human, Mouse, Rat, Bovine, Canine
- Host
- Rabbit
- Antigen sequence
AGLSQSHDDLSNATATPSVRKKAGSFSRRLIKRFS
FKSKP KANGNPSPQL- Vial size
- 50 µg
Submitted references Insulin biosynthetic interaction network component, TMEM24, facilitates insulin reserve pool release.
Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
Pottekat A, Becker S, Spencer KR, Yates JR 3rd, Manning G, Itkin-Ansari P, Balch WE
Cell reports 2013 Sep 12;4(5):921-30
Cell reports 2013 Sep 12;4(5):921-30
Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
Olsen JV, Blagoev B, Gnad F, Macek B, Kumar C, Mortensen P, Mann M
Cell 2006 Nov 3;127(3):635-48
Cell 2006 Nov 3;127(3):635-48
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image

- Experimental details
- Image(s): Western Blotting