HPA023609

CEP295NL antibody from Sigma-Aldrich
DDC8, KIAA1731NL
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA023609
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA023609, RRID:AB_10610974
Product name
Anti-AC100788.1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA023609
Antibody type
Polyclonal
Antigen
cDNA FLJ32655 fis, clone TESTI1000025, weakly similar to M.musculus testis-specific protein, DDC8 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
TPRGKKMADPEMLPAGEPRSPAEEEAQQAASKTDL
KTFMGKAQNQKYQGTVKPTFRNGSQTLSPEAGIFI
NKEDSLLYSTESGQETPKLGTLA
Storage
-20C
Provider Type Product Number
- No reagents -