HPA027257

TESK2 antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA027257
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA027257, RRID:AB_10602477
Product name
Anti-TESK2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA027257
Antibody type
Polyclonal
Antigen
testis-specific kinase 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
TLEEILSRLQEEEQERDRKLQPTARGLLEKAPGVK
RLSSLDDKIPHKSPCPRRTIWLSRSQSDIFSRKPP
RTVSVLDPYYRPRDGAARTPKVNPFSARQDLMGGK
IKFFDLPSKSVISLVF
Storage
-20C
Provider Type Product Number
- No reagents -