HPA027399

MMACHC antibody from Sigma-Aldrich
cblC, DKFZP564I122
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA027399
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA027399, RRID:AB_10601987
Product name
Anti-MMACHC antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA027399
Antibody type
Polyclonal
Antigen
methylmalonic aciduria (cobalamin deficiency) cblC type, with homocystinuria recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MEPKVAELKQKIEDTLCPFGFEVYPFQVAWYNELL
PPAFHLPLPGPTLAFLVLSTPAMFDRALKPFLQSC
HLRMLTDPVDQCVAYHLGRVRE
Storage
-20C
Provider Type Product Number
- No reagents -