HPA030790

RBFOX3 antibody from MilliporeSigma / Merck KGaA
FOX-3, HRNBP3, NeuN
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA030790
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA030790, RRID:AB_10602305
Product name
Anti-AC021534.2 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA030790
Antibody type
Polyclonal
Antigen
Fox-1 homolog C recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PTQDYSGQTPVPTEHGMTLYTPAQTHPEQPGSEAS
TQPIAGTQTVPQTDEAAQTDSQPLHPSDPTEKQQ
Storage
-20C
Provider Type Product Number
- No reagents -