H00118472-M01A

ZNF511 antibody from Abnova Corporation
MGC30006
No application information provided.

Antibody data

Product number
H00118472-M01A
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00118472-M01A, RRID:AB_1137076
Product name
ZNF511 monoclonal antibody (M01A), clone 3C10-1A3
Provider product page
Abnova Corporation - H00118472-M01A
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant ZNF511.
Antigen sequence
PLPVERDPAAGAAPFRFVARPVRFPREHQFFEDGD
VQRHLYLQDVIMQVADVPEKPRVPAFACQVAGCCQ
VFDALDDYEHHYHTLHGNVCSFCKRAFPSGHLLDA
HILEWHDSLFQILSERQDMYQCLVEGCTEKFKTSR
DRKDHMVRMHLYPADFRFDKPKKSRSPASAEAPGD
SGERSEGEAMEICSEPVAASPAPAGERRIYRHRIP
STICFGQGAARGFKSNKKKTKQC
Isotype
IgM
Antibody clone number
3C10-1A3
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -