H00079849-M01A

PDZD3 antibody from Abnova Corporation
FLJ22756, IKEPP, PDZK2
No application information provided.

Antibody data

Product number
H00079849-M01A
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00079849-M01A, RRID:AB_1204777
Product name
PDZD3 monoclonal antibody (M01A), clone 2G1
Provider product page
Abnova Corporation - H00079849-M01A
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant PDZD3.
Antigen sequence
MEKAADLQDTASLTLKFKFNPKLGIDNPVLSLAED
HDPYDPWSLERPRFCLLSKEEGKSFGFHLQQELGR
AGHVVCRVDPGTSAQRQGLQEGDRILAVNNDVVEH
EDYAVVVRRIRASSPRVLLTVLARHAHDVARAQLG
EDAHLCPTLGPGVRPRLCHIVKDEGGFGFSVTHGN
QGPFWLVLSTGGAAERAGVPPGARLLEVNGLWQSG
QQVTLLVAGPEVEEQCRQLGLPLAAPLAEGWALPT
KPRCLHLEKGPQGFGFLLREEKGLDGRPGQFLWEV
DPGLPAKKAGMQAGDRLVAVAGESVEGLGHEETVS
RIQGQGSCVSLTVVDPEADRFFSMVRLSPLLFLEN
TEAPASPQGSSSASLVETEDPSLEDTSVPSVPLGS
RQCFLYPGPGGSYGFRLSCVASGPRLFISQVTPGG
SAARAGLQVGDVILEVNGYPVGGQNDLERLQQLPE
AEPPLCLKLAARSLRGLEAWIPPGAAEDWALASDL
L
Isotype
IgM
Antibody clone number
2G1
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -