HPA055767

SERPIND1 antibody from Atlas Antibodies
D22S673, HC-II, HC2, HCF2, HLS2
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA055767
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA055767, RRID:AB_2682912
Product name
Anti-SERPIND1
Provider product page
Atlas Antibodies - HPA055767
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
EAQIADFSDPAFISKTNNHIMKLTKGLIKDALENI
DPATQMMILNCIYFKGSWVNKFPVEMTHNHNFRLN
E
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -