Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN502098 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-serpin Peptidase Inhibitor, Clade D (Heparin Cofactor), Member 1 (SERPIND1) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-SERPIND1 antibody: synthetic peptide directed towards the middle region of human SERPIND1
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat
- Host
- Rabbit
- Antigen sequence
VSMMQTKGNFLAANDQELDCDILQLEYVGGISMLI
VVPHK MSGMKTLEAQ- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Beta2-glycoprotein I protects thrombin from inhibition by heparin cofactor II: potentiation of this effect in the presence of anti-beta2-glycoprotein I autoantibodies.
Rahgozar S, Giannakopoulos B, Yan X, Wei J, Cheng Qi J, Gemmell R, Krilis SA
Arthritis and rheumatism 2008 Apr;58(4):1146-55
Arthritis and rheumatism 2008 Apr;58(4):1146-55
No comments: Submit comment
No validations: Submit validation data