ABIN502098

SERPIND1 antibody from antibodies-online
D22S673, HC-II, HC2, HCF2, HLS2

Antibody data

Product number
ABIN502098
Provider
antibodies-online
Product name
anti-serpin Peptidase Inhibitor, Clade D (Heparin Cofactor), Member 1 (SERPIND1) (Middle Region) antibody
Provider product page
antibodies-online - ABIN502098
Antibody type
Polyclonal
Antigen
The immunogen for anti-SERPIND1 antibody: synthetic peptide directed towards the middle region of human SERPIND1
Description
Affinity Purified
Reactivity
Human, Mouse, Rat
Host
Rabbit
Antigen sequence
VSMMQTKGNFLAANDQELDCDILQLEYVGGISMLI
VVPHK MSGMKTLEAQ
Epitope
Middle Region
Vial size
50 μg
Concentration
1mg/mL
Storage
-20°C
Handling
Avoid repeated freeze-thaw cycles.
Provider Type Product Number
- No reagents -