SAB1401170

SERPIND1 antibody from MilliporeSigma / Merck KGaA
D22S673, HC-II, HC2, HCF2, HLS2
No application information provided.

Antibody data

Product number
SAB1401170
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#SAB1401170, RRID:AB_10609452
Product name
Anti-SERPIND1 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - SAB1401170
Antibody type
Polyclonal
Antigen
SERPIND1 (AAH35028.1, 1 a.a. ~ 499 a.a) full-length human protein.
Description
purified immunoglobulin
Reactivity
Human
Antigen sequence
MKHSLNALLIFLIITSAWGGSKGPLDQLEKGGETA
QSADPQWEQLNNKNLSMPLLPADFHKENTVTNDWI
PEGEEDDDYLDLEKIFSEDDDYIDIVDSLSVSPTD
SDVSAGNILQLFHGKSRIQRLNIVNAKFAFNLYRV
LKDQVNTFDNIFIAPVGISTAMGMISLGLKGETHE
QVHSILHFKDFVNASSKYEITTIHNLFRKLTHRLF
RRNFGYTLRSVNDLYIQKQFPILLDFKTKVREYYF
AEAQIADFSD
Storage
-20C
Provider Type Product Number
- No reagents -