Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00002548-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00002548-M01, RRID:AB_464382
- Product name
- GAA monoclonal antibody (M01), clone 3C6
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant GAA.
- Antigen sequence
GEARGELFWDDGESLEVLERGAYTQVIFLARNNTI
VNELVRVTSEGAGLQLQKVTVLGVATAPQQVLSNG
VPVSNFTYSPDTKVLDICVSLLMGEQFLVSWC- Isotype
- IgG
- Antibody clone number
- 3C6
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Discovery of a novel noniminosugar acid α glucosidase chaperone series.
Xiao J, Westbroek W, Motabar O, Lea WA, Hu X, Velayati A, Zheng W, Southall N, Gustafson AM, Goldin E, Sidransky E, Liu K, Simeonov A, Tamargo RJ, Ribes A, Matalonga L, Ferrer M, Marugan JJ
Journal of medicinal chemistry 2012 Sep 13;55(17):7546-59
Journal of medicinal chemistry 2012 Sep 13;55(17):7546-59
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged GAA is 0.3 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol