Antibody data
- Antibody Data
- Antigen structure
- References [4]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA030205 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA030205, RRID:AB_10600712
- Product name
- Anti-HEY2
- Antibody type
- Polyclonal
- Description
- Affinity purified using the PrEST antigen as affinity ligand
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
YLSSVEGLDSSDPLRVRLVSHLSTCATQREAAAMT
SSMAHHHHPLHPHHWAAAFHHLPAALLQPN- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references The transcriptional repressor HEY2 regulates mitochondrial oxidative respiration to maintain cardiac homeostasis
Arterialization and anomalous vein wall remodeling in varicose veins is associated with upregulated FoxC2-Dll4 pathway
Hyperacetylation of Microtubules in Mesenchymal Cells Increases Cytokeratin 14–Positive Epithelial Progenitors in Developing Salivary Glands
HEY2, a target of miR-137, indicates poor outcomes and promotes cell proliferation and migration in hepatocellular carcinoma
She P, Gao B, Li D, Wu C, Zhu X, He Y, Mo F, Qi Y, Jin D, Chen Y, Zhao X, Lin J, Hu H, Li J, Zhang B, Xie P, Lin C, Christoffels V, Wu Y, Zhu P, Zhong T
Nature Communications 2025;16(1)
Nature Communications 2025;16(1)
Arterialization and anomalous vein wall remodeling in varicose veins is associated with upregulated FoxC2-Dll4 pathway
Surendran S, S Ramegowda K, Suresh A, Binil Raj S, Lakkappa R, Kamalapurkar G, Radhakrishnan N, C Kartha C
Laboratory Investigation 2016;96(4):399-408
Laboratory Investigation 2016;96(4):399-408
Hyperacetylation of Microtubules in Mesenchymal Cells Increases Cytokeratin 14–Positive Epithelial Progenitors in Developing Salivary Glands
Joo E, Lombaert I, Yamada K
Journal of Dental Research 2016;95(13):1518-1527
Journal of Dental Research 2016;95(13):1518-1527
HEY2, a target of miR-137, indicates poor outcomes and promotes cell proliferation and migration in hepatocellular carcinoma
Wu D, Zhang M, Su S, Fang H, Wang X, He D, Xie Y, Liu X
Oncotarget 2016;7(25):38052-38063
Oncotarget 2016;7(25):38052-38063
No comments: Submit comment
No validations: Submit validation data