HPA026993

TMEM69 antibody from Sigma-Aldrich
C1orf154, FLJ21029
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA026993
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA026993, RRID:AB_10601824
Product name
Anti-TMEM69 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA026993
Antibody type
Polyclonal
Antigen
transmembrane protein 69 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PVGLRTSRTDILSLKMSLQQNFSPCPRPWLSSSFP
AYMSKTQCYHTSPCSFKKQQKQALLARPSSTITYL
TDSPKPALCVTLAGLIPFVAPPLV
Storage
-20C
Provider Type Product Number
- No reagents -