SAB2101170

IPP antibody from MilliporeSigma / Merck KGaA
KLHL27
No application information provided.

Antibody data

Product number
SAB2101170
Provider
MilliporeSigma / Merck KGaA
Product name
Anti-IPP antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - SAB2101170
Antibody type
Polyclonal
Antigen
Peptide region of the protein sequence according to NP_005888.
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
CCEMQGLIYVIGGISNEGIELRSFEVYDPLSKRWS
PLPPMGTRRAYLGVA
Storage
-20C