HPA023225

RPS6KA4 antibody from Sigma-Aldrich
MSK2, RSK-B
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA023225
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA023225, RRID:AB_1854144
Product name
Anti-RPS6KA4 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA023225
Antibody type
Polyclonal
Antigen
Ribosomal protein S6 kinase alpha-4 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
AQEVRNHPFFQGLDWVALAARKIPAPFRPQIRSEL
DVGNFAEEFTRLEPVYSPPGSPPPGDPRIFQGYSF
VAPSILFDHNNAVMTDGLEAPGAGDRPGRAAVARS
AMMQDSPFFQQYELDLREPALGQGSFSVC
Storage
-20C
Provider Type Product Number
- No reagents -