HPA027914

HINT3 antibody from Sigma-Aldrich
FLJ33126, HINT4
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA027914
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA027914, RRID:AB_10602424
Product name
Anti-HINT3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA027914
Antibody type
Polyclonal
Antigen
histidine triad nucleotide binding protein 3 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MAEEQVNRSAGLAPDCEASATAETTVSSVGTCEAA
AKSPEPKDYDSTCVFCRIAGRQDPGTELLHCENED
LICFKDIKPAATHHYLVVP
Storage
-20C
Provider Type Product Number
- No reagents -