Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [3]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00010935-B01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00010935-B01, RRID:AB_1114808
- Product name
- PRDX3 MaxPab mouse polyclonal antibody (B01)
- Antibody type
- Polyclonal
- Description
- Mouse polyclonal antibody raised against a full-length human PRDX3 protein.
- Antigen sequence
MAAAVGRLLRASVARHVSAIPWGISATAALRPAAC
GRTSLTNLLCSGSSQAKLFSTSSSCHAPAVTQHAP
YFKGTAVVNGEFKDLSLDDFKGKYLVLFFYPLDFT
FVCPTEIVAFSDKANEFHDVNCEVVAVSVDSHFSH
LAWINTPRKNGGLGHMNIALLSDLTKQISRDYGVL
LEGSGLALRGLFIIDPNGVIKHLSVNDLPVGRSVE
ETLRLVKAFQYVETHGEVCPANWTPDSPTIKPSPA
ASKEYFQKVNQ- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Glutathione-dependent and -independent oxidative stress-control mechanisms distinguish normal human mammary epithelial cell subsets.
Kannan N, Nguyen LV, Makarem M, Dong Y, Shih K, Eirew P, Raouf A, Emerman JT, Eaves CJ
Proceedings of the National Academy of Sciences of the United States of America 2014 May 27;111(21):7789-94
Proceedings of the National Academy of Sciences of the United States of America 2014 May 27;111(21):7789-94
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of PRDX3 expression in transfected 293T cell line (H00010935-T01) by PRDX3 MaxPab polyclonal antibody.Lane 1: PRDX3 transfected lysate(28.16 KDa).Lane 2: Non-transfected lysate.
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- PRDX3 MaxPab polyclonal antibody. Western Blot analysis of PRDX3 expression in A-549.
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- PRDX3 MaxPab polyclonal antibody. Western Blot analysis of PRDX3 expression in human kidney.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of purified MaxPab antibody to PRDX3 on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol